PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00072327001
Common NameGSBRNA2T00072327001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 1059aa    MW: 117202 Da    PI: 6.774
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00072327001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.2e-23126227199
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  GSBRNA2T00072327001 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFV 213
                          99*****************************954.4444.48************************************************ PP

                          E-SSSEE..EEEEE-S CS
                   B3  84 ldgrsefelvvkvfrk 99 
                            ++++ +l+++++r+
  GSBRNA2T00072327001 214 --RDEKSQLTLGIRRA 227
                          ..45677789999997 PP

2Auxin_resp118.65.2e-39252334183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  GSBRNA2T00072327001 252 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 334
                          799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.92E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-41120241IPR015300DNA-binding pseudobarrel domain
CDDcd100179.47E-21125226No hitNo description
PfamPF023622.0E-21126227IPR003340B3 DNA binding domain
SMARTSM010194.3E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.492126228IPR003340B3 DNA binding domain
PfamPF065077.3E-34252334IPR010525Auxin response factor
PfamPF023091.3E-99281016IPR033389AUX/IAA domain
PROSITE profilePS5174525.0019301015IPR000270PB1 domain
SuperFamilySSF542774.07E-89441008No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1059 aa     Download sequence    Send to blast
MKAPSNGFHP NPTEGEKKAI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKINR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFVRDEKSQL TLGIRRANRQ TPTLSSSVIS  240
SDSMHIGILA AAAHANANSS PFTIFFNPRA SPSEFVVPLA KYNKALYAQV SLGMRFRMMF  300
ETEDCGVRRY MGTVTGISDL DPVRWKGSQW RNLQVGWDES TAGDRPSRVS IWEIEPVITP  360
FYICPPPFFR PKYPRQPGMP DDELDMENAF KRAMPWMGEE FGMKDAQSSM FPGLSLVQWM  420
SMQQNNPLSA GAAAATTHLP SSYNLPNNFA PNDHSKLLNF QSPNLSPANT QFNKPNMVSH  480
ISQQMQAQPA MVQSQQQQQQ QQQQQLQQQV QMSHQQLQQQ HHQHQQQGGY NSGSVNNGVS  540
VVSNQVSCQN QSAGFTQSQL QQQSMLSNGA KMTHQNMVSA GNKGSSQMTA QELQFQQQLE  600
LHNSTQLLRN QQEQSSMHSL QQNPQQLQMQ QQQSSKPSPS QQLQLQLLQK LQQQQQLTPP  660
PVSSSSQPQL SSLQQTQSHQ LQQLLSSQNQ QPLPQSNNNS FMQPPQIQAS HHQQQGYMNN  720
NKPIVRSQSG HIDGEAPSCS TSPSANNTGH GNVSPTNFLS RNQQQGQGVS VPASDPVQQG  780
MVNLKSAGEQ FKFKAAVTDQ IGVTTAGTTY CPDVVVGPGQ QQQQTFPLPS FGFDGDLQQS  840
QHPRNSLAFA GNIEAVNPDA LYSQKDFQNL VVPNYGNAPR DIETELSSAS QSFGIPSIPF  900
KSGGSNEIGG INDSGIMNGG IWPNQAQRMR TYTKVQKRGS VGRSIDVTRY SGYEELRNDL  960
ARMFGIEGQL EDPQISDWKL VYTDHENDIL LVGDDPWEEF VNCVQNVKIL SSAEVQQMSL  1020
DGDLAAIPTT NQACSETDSG NAWKVHYEDT SAAASFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1711635547388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.78440.0flower
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00072327001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794840.0JN979484.1 Brassica rapa subsp. pekinensis auxin response factor 19-2 (ARF19-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586633.10.0PREDICTED: auxin response factor 19 isoform X1
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLA0A078HR470.0A0A078HR47_BRANA; Auxin response factor
STRINGBra025720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]